c jun blocking peptide Search Results


antigenic (blocking) peptide (sequence: mvasasrpe-c  (Synaptic Systems)
90
Synaptic Systems antigenic (blocking) peptide (sequence: mvasasrpe-c
Antigenic (Blocking) Peptide (Sequence: Mvasasrpe C, supplied by Synaptic Systems, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/antigenic (blocking) peptide (sequence: mvasasrpe-c/product/Synaptic Systems
Average 90 stars, based on 1 article reviews
antigenic (blocking) peptide (sequence: mvasasrpe-c - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier
antigenic (blocking) peptide mvasasrpe-c  (Synaptic Systems)
90
Synaptic Systems antigenic (blocking) peptide mvasasrpe-c
Antigenic (Blocking) Peptide Mvasasrpe C, supplied by Synaptic Systems, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/antigenic (blocking) peptide mvasasrpe-c/product/Synaptic Systems
Average 90 stars, based on 1 article reviews
antigenic (blocking) peptide mvasasrpe-c - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier
human atp13a2 c-terminal blocking peptide  (United Biosystems Inc)
90
United Biosystems Inc human atp13a2 c-terminal blocking peptide
Human Atp13a2 C Terminal Blocking Peptide, supplied by United Biosystems Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/human atp13a2 c-terminal blocking peptide/product/United Biosystems Inc
Average 90 stars, based on 1 article reviews
human atp13a2 c-terminal blocking peptide - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier
pannexin-1 mimetic blocking peptide 10panx (wrqaafvdsy, with c-terminal amidation)  (Biomatik)
90
Biomatik pannexin-1 mimetic blocking peptide 10panx (wrqaafvdsy, with c-terminal amidation)
Pannexin 1 Mimetic Blocking Peptide 10panx (Wrqaafvdsy, With C Terminal Amidation), supplied by Biomatik, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/pannexin-1 mimetic blocking peptide 10panx (wrqaafvdsy, with c-terminal amidation)/product/Biomatik
Average 90 stars, based on 1 article reviews
pannexin-1 mimetic blocking peptide 10panx (wrqaafvdsy, with c-terminal amidation) - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier
pannexin-1 mimetic blocking peptide 10 panx (wrqaafvdsy, with c-terminal amidation)  (Biomatik)
90
Biomatik pannexin-1 mimetic blocking peptide 10 panx (wrqaafvdsy, with c-terminal amidation)
Pannexin 1 Mimetic Blocking Peptide 10 Panx (Wrqaafvdsy, With C Terminal Amidation), supplied by Biomatik, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/pannexin-1 mimetic blocking peptide 10 panx (wrqaafvdsy, with c-terminal amidation)/product/Biomatik
Average 90 stars, based on 1 article reviews
pannexin-1 mimetic blocking peptide 10 panx (wrqaafvdsy, with c-terminal amidation) - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier
blocking peptide for anti-c-tau antibody csstgsedmvd  (GenScript corporation)
90
GenScript corporation blocking peptide for anti-c-tau antibody csstgsedmvd
Blocking Peptide For Anti C Tau Antibody Csstgsedmvd, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/blocking peptide for anti-c-tau antibody csstgsedmvd/product/GenScript corporation
Average 90 stars, based on 1 article reviews
blocking peptide for anti-c-tau antibody csstgsedmvd - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier
peptide building blocks (d)-b, (l)-/(d)-c, (l)-/(d)-d  (GenScript corporation)
90
GenScript corporation peptide building blocks (d)-b, (l)-/(d)-c, (l)-/(d)-d
Peptide Building Blocks (D) B, (L) /(D) C, (L) /(D) D, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/peptide building blocks (d)-b, (l)-/(d)-c, (l)-/(d)-d/product/GenScript corporation
Average 90 stars, based on 1 article reviews
peptide building blocks (d)-b, (l)-/(d)-c, (l)-/(d)-d - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier
gbg-blocking peptide mps phosducin-like protein c-terminus: aavallpavllallavtdqlgedffavdleaflqefgllpeke  (AnaSpec)
90
AnaSpec gbg-blocking peptide mps phosducin-like protein c-terminus: aavallpavllallavtdqlgedffavdleaflqefgllpeke
Gbg Blocking Peptide Mps Phosducin Like Protein C Terminus: Aavallpavllallavtdqlgedffavdleaflqefgllpeke, supplied by AnaSpec, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/gbg-blocking peptide mps phosducin-like protein c-terminus: aavallpavllallavtdqlgedffavdleaflqefgllpeke/product/AnaSpec
Average 90 stars, based on 1 article reviews
gbg-blocking peptide mps phosducin-like protein c-terminus: aavallpavllallavtdqlgedffavdleaflqefgllpeke - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier
antibodies against c myc peptide  (Novus Biologicals)
86
Novus Biologicals antibodies against c myc peptide
Antibodies Against C Myc Peptide, supplied by Novus Biologicals, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/antibodies against c myc peptide/product/Novus Biologicals
Average 86 stars, based on 1 article reviews
antibodies against c myc peptide - by Bioz Stars, 2026-06
86/100 stars
  Buy from Supplier
foxp2 (c terminus) blocking peptide gtx47606  (GeneTex)
90
GeneTex foxp2 (c terminus) blocking peptide gtx47606
Foxp2 (C Terminus) Blocking Peptide Gtx47606, supplied by GeneTex, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/foxp2 (c terminus) blocking peptide gtx47606/product/GeneTex
Average 90 stars, based on 1 article reviews
foxp2 (c terminus) blocking peptide gtx47606 - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier
crystallin gamma c blocking peptide  (Biosynth Carbosynth)
N/A
A synthetic peptide for use as a blocking control in assays to test for specificity of CRYGC antibody, catalog no. 70R-2030
   Buy from Supplier
chymotrypsin c blocking peptide  (Biosynth Carbosynth)
N/A
A synthetic peptide for use as a blocking control in assays to test for specificity of CTRC antibody, catalog no. 70R-5465
   Buy from Supplier

Image Search Results